IL12B

IL12B
Наявні структури
PDBПошук ортологів: PDBe RCSB
Список кодів PDB

1F42, 1F45, 3D85, 3D87, 3DUH, 3HMX, 3QWR, 4GRW, 4OE8, 4OG9

Ідентифікатори
Символи IL12B, CLMF, CLMF2, IL-12B, IMD28, NKSF, NKSF2, IMD29, Interleukin 12 subunit beta, interleukin 12B
Зовнішні ІД OMIM: 161561 MGI: 96540 HomoloGene: 1648 GeneCards: IL12B
Пов'язані генетичні захворювання
Псоріаз, papulosquamous disorder[1]
Реагує на сполуку
tildrakizumab[2]
Онтологія гена
Молекулярна функція

cytokine activity
interleukin-23 receptor binding
protein homodimerization activity
interleukin-12 receptor binding
GO:0001948, GO:0016582 protein binding
identical protein binding
protein heterodimerization activity
interleukin-12 alpha subunit binding
GO:0016518 cytokine receptor activity
growth factor activity
GO:0005145 cytokine receptor binding
GO:0019974 cytokine binding

Клітинна компонента

цитоплазма
мембрана
interleukin-12 complex
interleukin-23 complex
extracellular region
міжклітинний простір
endoplasmic reticulum lumen
гіалоплазма
late endosome lumen
cell surface
external side of plasma membrane
receptor complex

Біологічний процес

positive regulation of cell adhesion
negative regulation of interleukin-10 production
negative regulation of smooth muscle cell proliferation
positive regulation of inflammatory response
статеве розмноження
positive regulation of interleukin-12 production
positive regulation of smooth muscle cell apoptotic process
GO:0051636 defense response to Gram-negative bacterium
positive regulation of interleukin-10 production
positive regulation of T cell mediated cytotoxicity
natural killer cell activation
positive regulation of natural killer cell activation
positive regulation of interferon-gamma production
positive regulation of osteoclast differentiation
positive regulation of T-helper 17 cell lineage commitment
response to organic substance
positive regulation of NK T cell activation
positive regulation of natural killer cell proliferation
natural killer cell activation involved in immune response
cell surface receptor signaling pathway
positive regulation of NK T cell proliferation
positive regulation of T-helper 17 type immune response
negative regulation of inflammatory response to antigenic stimulus
defense response to virus
positive regulation of tissue remodeling
positive regulation of T-helper 1 type immune response
positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target
positive regulation of granulocyte macrophage colony-stimulating factor production
positive regulation of T cell proliferation
positive regulation of memory T cell differentiation
cellular response to interferon-gamma
positive regulation of tumor necrosis factor production
T-helper 1 type immune response
sensory perception of pain
response to UV-B
positive regulation of interleukin-17 production
cellular response to lipopolysaccharide
negative regulation of interleukin-17 production
T-helper cell differentiation
cell migration
positive regulation of lymphocyte proliferation
positive regulation of mononuclear cell proliferation
positive regulation of activated T cell proliferation
defense response to protozoan
positive regulation of defense response to virus by host
positive regulation of activation of Janus kinase activity
regulation of tyrosine phosphorylation of STAT protein
positive regulation of tyrosine phosphorylation of STAT protein
interleukin-12-mediated signaling pathway
проліферація
regulation of signaling receptor activity
T-helper 1 cell cytokine production
cytokine-mediated signaling pathway
interleukin-23-mediated signaling pathway
positive regulation of NIK/NF-kappaB signaling

Джерела:Amigo / QuickGO
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
3593
16160
Ensembl
ENSG00000113302
ENSMUSG00000004296
UniProt
P29460
P43432
RefSeq (мРНК)
NM_002187
NM_008352
NM_001303244
RefSeq (білок)
NP_002178
NP_001290173
Локус (UCSC) Хр. 5: 159.31 – 159.33 Mb Хр. 11: 44.29 – 44.3 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

IL12B (англ. Interleukin 12B) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми. [5] Довжина поліпептидного ланцюга білка становить 328 амінокислот, а молекулярна маса — 37 169[6].

Послідовність амінокислот
1020304050
MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTC
DTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHS
LLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTIST
DLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACP
AAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSR
QVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVIC
RKNASISVRAQDRYYSSSWSEWASVPCS

Кодований геном білок за функцією належить до цитокінів. Задіяний у такому біологічному процесі як поліморфізм. Секретований назовні.

Література

  • Huang D., Cancilla M.R., Morahan G. (2000). Complete primary structure, chromosomal localization, and definition of polymorphisms of the gene encoding the human interleukin 12 p40 subunit. Genes Immun. 1: 515—520. PMID 11197695 DOI:10.1038/sj.gene.6363720
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Gearing D.P., Cosman D. (1991). Homology of the p40 subunit of natural killer cell stimulatory factor (NKSF) with the extracellular domain of the interleukin-6 receptor. Cell. 66: 9—10. PMID 2070420 DOI:10.1016/0092-8674(91)90131-H
  • D'Andrea A., Ma X., Aste-Amezaga M., Paganin C., Trinchieri G. (1995). Stimulatory and inhibitory effects of interleukin (IL)-4 and IL-13 on the production of cytokines by human peripheral blood mononuclear cells: priming for IL-12 and tumor necrosis factor alpha production. J. Exp. Med. 181: 537—546. PMID 7836910 DOI:10.1084/jem.181.2.537
  • Doucey M.A., Hess D., Blommers M.J., Hofsteenge J. (1999). Recombinant human interleukin-12 is the second example of a C-mannosylated protein. Glycobiology. 9: 435—441. PMID 10207176 DOI:10.1093/glycob/9.5.435
  • Lupardus P.J., Garcia K.C. (2008). The structure of interleukin-23 reveals the molecular basis of p40 subunit sharing with interleukin-12. J. Mol. Biol. 382: 931—941. PMID 18680750 DOI:10.1016/j.jmb.2008.07.051

Примітки

  1. Захворювання, генетично пов'язані з IL12B переглянути/редагувати посилання на ВікіДаних.
  2. Сполуки, які фізично взаємодіють з Interleukin 12B переглянути/редагувати посилання на ВікіДаних.
  3. Human PubMed Reference:.
  4. Mouse PubMed Reference:.
  5. HUGO Gene Nomenclature Commitee, HGNC:5970 (англ.) . Процитовано 31 серпня 2017.{{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  6. UniProt, P29460 (англ.) . Архів оригіналу за 1 жовтня 2017. Процитовано 31 серпня 2017.

Див. також

  • Хромосома 5
Молекула міоглобіну Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.

П:  Портал «Біологія» П:  Портал «Хімія»