BMP7

BMP7
Наявні структури
PDBПошук ортологів: PDBe RCSB
Список кодів PDB

1BMP, 1LX5, 1LXI, 1M4U

Ідентифікатори
Символи BMP7, OP-1, bone morphogenetic protein 7
Зовнішні ІД OMIM: 112267 MGI: 103302 HomoloGene: 20410 GeneCards: BMP7
Онтологія гена
Молекулярна функція

• heparin binding
• cytokine activity
• transforming growth factor beta receptor binding
• growth factor activity
• BMP receptor binding
• GO:0001948, GO:0016582 protein binding

Клітинна компонента

• extracellular region
• GO:0005578 Позаклітинна матриця
• міжклітинний простір
• везикула
• collagen-containing extracellular matrix

Біологічний процес

• розвиток ока
• pattern specification process
• skeletal system development
• ureteric bud development
• negative regulation of neuron differentiation
• embryonic pattern specification
• mesenchyme development
• anatomical structure formation involved in morphogenesis
• negative regulation of cell cycle
• mesonephros development
• odontogenesis of dentin-containing tooth
• mesenchymal cell differentiation
• negative regulation of mitotic nuclear division
• animal organ morphogenesis
• metanephric mesenchyme morphogenesis
• metanephros development
• cellular response to hypoxia
• regulation of pathway-restricted SMAD protein phosphorylation
• regulation of removal of superoxide radicals
• steroid hormone mediated signaling pathway
• negative regulation of Notch signaling pathway
• negative regulation of cell population proliferation
• branching involved in salivary gland morphogenesis
• regulation of apoptotic process
• SMAD protein signal transduction
• осифікація
• розвиток нирки
• negative regulation of cell death
• tube morphogenesis
• GO:0060469, GO:0009371 positive regulation of transcription, DNA-templated
• negative regulation of prostatic bud formation
• cartilage development
• embryonic limb morphogenesis
• negative regulation of MAP kinase activity
• embryonic camera-type eye morphogenesis
• positive regulation of neuron differentiation
• positive regulation of cell differentiation
• negative regulation of phosphorylation
• regulation of branching involved in prostate gland morphogenesis
• диференціація клітин
• neuron projection morphogenesis
• nephrogenic mesenchyme morphogenesis
• positive regulation of heterotypic cell-cell adhesion
• epithelial cell differentiation
• response to vitamin D
• positive regulation of hyaluranon cable assembly
• positive regulation of bone mineralization
• dendrite development
• negative regulation of neurogenesis
• regulation of phosphorylation
• BMP signaling pathway
• positive regulation of osteoblast differentiation
• Епітеліально-мезенхімальний перехід
• GO:0045996 negative regulation of transcription, DNA-templated
• negative regulation of NF-kappaB transcription factor activity
• branching morphogenesis of an epithelial tube
• negative regulation of mesenchymal cell apoptotic process involved in nephron morphogenesis
• negative regulation of glomerular mesangial cell proliferation
• response to estradiol
• monocyte aggregation
• metanephric mesenchymal cell proliferation involved in metanephros development
• positive regulation of cell death
• розвиток клітин
• negative regulation of striated muscle cell apoptotic process
• positive regulation of pathway-restricted SMAD protein phosphorylation
• mesoderm formation
• response to peptide hormone
• cellular response to BMP stimulus
• positive regulation of dendrite development
• salivary gland morphogenesis
• axon guidance
• multicellular organism development
• positive regulation of peptidyl-threonine phosphorylation
• positive regulation of apoptotic process
• protein localization to nucleus
• embryonic skeletal joint morphogenesis
• camera-type eye morphogenesis
• GO:0003257, GO:0010735, GO:1901228, GO:1900622, GO:1904488 positive regulation of transcription by RNA polymerase II
• endocardial cushion formation
• pericardium morphogenesis
• neural fold elevation formation
• hindbrain development
• cardiac muscle tissue development
• pharyngeal system development
• cardiac septum morphogenesis
• chorio-allantoic fusion
• heart trabecula morphogenesis
• allantois development
• positive regulation of epithelial to mesenchymal transition
• positive regulation of cardiac neural crest cell migration involved in outflow tract morphogenesis
• regulation of signaling receptor activity
• GO:1901313 positive regulation of gene expression
• negative regulation of NIK/NF-kappaB signaling
• regulation of MAPK cascade

Джерела:Amigo / QuickGO
Ортологи
Види Людина Миша
Entrez
655
12162
Ensembl
ENSG00000101144
ENSMUSG00000008999
UniProt
P18075
P23359
RefSeq (мРНК)
NM_001719
NM_007557
RefSeq (білок)
NP_001710
NP_001710.1
NP_031583
Локус (UCSC) Хр. 20: 57.17 – 57.27 Mb Хр. 2: 172.71 – 172.78 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

BMP7 (англ. Bone morphogenetic protein 7) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 431 амінокислот, а молекулярна маса — 49 313[4].

Послідовність амінокислот
1020304050
MHVRSLRAAAPHSFVALWAPLFLLRSALADFSLDNEVHSSFIHRRLRSQE
RREMQREILSILGLPHRPRPHLQGKHNSAPMFMLDLYNAMAVEEGGGPGG
QGFSYPYKAVFSTQGPPLASLQDSHFLTDADMVMSFVNLVEHDKEFFHPR
YHHREFRFDLSKIPEGEAVTAAEFRIYKDYIRERFDNETFRISVYQVLQE
HLGRESDLFLLDSRTLWASEEGWLVFDITATSNHWVVNPRHNLGLQLSVE
TLDGQSINPKLAGLIGRHGPQNKQPFMVAFFKATEVHFRSIRSTGSKQRS
QNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIA
PEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQ
LNAISVLYFDDSSNVILKKYRNMVVRACGCH

Кодований геном білок за функціями належить до цитокінів, факторів росту, білків розвитку. Задіяний у таких біологічних процесах, як остеогенез, диференціація клітин. Секретований назовні.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Wyatt A.W., Osborne R.J., Stewart H., Ragge N.K. (2010). Bone morphogenetic protein 7 (BMP7) mutations are associated with variable ocular, brain, ear, palate, and skeletal anomalies. Hum. Mutat. 31: 781—787. PMID 20506283 DOI:10.1002/humu.21280
  • Griffith D.L., Keck P.C., Sampath T.K., Rueger D.C., Carlson W.D. (1996). Three-dimensional structure of recombinant human osteogenic protein 1: structural paradigm for the transforming growth factor beta superfamily. Proc. Natl. Acad. Sci. U.S.A. 93: 878—883. PMID 8570652 DOI:10.1073/pnas.93.2.878

Примітки

  1. ↑ Human PubMed Reference:.
  2. ↑ Mouse PubMed Reference:.
  3. ↑ HUGO Gene Nomenclature Commitee, HGNC:1074 (англ.) . Процитовано 12 вересня 2017.
  4. ↑ UniProt, P18075 (англ.) . Архів оригіналу за 3 березня 2018. Процитовано 12 вересня 2017.

Див. також

  • Хромосома 20
Молекула міоглобіну Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.

П:  Портал «Біологія» П:  Портал «Хімія»

На цю статтю не посилаються інші статті Вікіпедії.
Будь ласка розставте посилання відповідно до прийнятих рекомендацій.