BMP4

BMP4
Ідентифікатори
Символи BMP4, BMP2B, BMP2B1, MCOPS6, OFC11, ZYME, bone morphogenetic protein 4
Зовнішні ІД OMIM: 112262 MGI: 88180 HomoloGene: 7247 GeneCards: BMP4
Онтологія гена
Молекулярна функція

heparin binding
cytokine activity
co-receptor binding
transforming growth factor beta receptor binding
growth factor activity
BMP receptor binding
GO:0001948, GO:0016582 protein binding
chemoattractant activity

Клітинна компонента

extracellular region
міжклітинний простір
endoplasmic reticulum lumen

Біологічний процес

embryonic skeletal system morphogenesis
negative regulation of T cell differentiation in thymus
germ cell development
skeletal system development
mesenchymal cell differentiation involved in renal system development
cardiac septum development
ureteric bud development
positive regulation of protein phosphorylation
renal system process
positive regulation of endothelial cell differentiation
negative regulation of immature T cell proliferation in thymus
bud elongation involved in lung branching
tendon cell differentiation
anatomical structure formation involved in morphogenesis
ureter epithelial cell differentiation
negative regulation of cell cycle
mesenchymal to epithelial transition involved in metanephros morphogenesis
trachea development
post-embryonic development
monocyte differentiation
specification of ureteric bud anterior/posterior symmetry by BMP signaling pathway
blood vessel endothelial cell proliferation involved in sprouting angiogenesis
BMP signaling pathway involved in renal system segmentation
cranial suture morphogenesis
mesonephros development
odontogenesis of dentin-containing tooth
telencephalon regionalization
negative regulation of chondrocyte differentiation
blood vessel development
negative regulation of mitotic nuclear division
Ангіогенез
prostate gland morphogenesis
positive regulation of ERK1 and ERK2 cascade
smooth muscle tissue development
BMP signaling pathway involved in heart induction
negative regulation of epithelial cell proliferation
гістогенез
metanephric collecting duct development
inner ear receptor cell differentiation
mesodermal cell fate determination
metanephros development
type B pancreatic cell development
regulation of pathway-restricted SMAD protein phosphorylation
negative regulation of cell population proliferation
steroid hormone mediated signaling pathway
mammary gland formation
positive regulation of collagen biosynthetic process
renal system development
negative regulation of myoblast differentiation
cell fate commitment
common-partner SMAD protein phosphorylation
glomerular visceral epithelial cell development
SMAD protein signal transduction
осифікація
розвиток нирки
lung development
ureter smooth muscle cell differentiation
embryonic digit morphogenesis
epithelial-mesenchymal cell signaling
negative regulation of thymocyte apoptotic process
mesenchymal cell differentiation involved in kidney development
negative regulation of cell death
regulation of odontogenesis of dentin-containing tooth
BMP signaling pathway involved in ureter morphogenesis
mesenchymal cell proliferation involved in ureteric bud development
smooth muscle cell differentiation
lymphoid progenitor cell differentiation
epithelium development
GO:0060469, GO:0009371 positive regulation of transcription, DNA-templated
deltoid tuberosity development
negative regulation of prostatic bud formation
heart development
telencephalon development
branching involved in ureteric bud morphogenesis
positive regulation of kidney development
cartilage development
embryonic limb morphogenesis
negative regulation of MAP kinase activity
positive regulation of cartilage development
lens induction in camera-type eye
positive regulation of neuron differentiation
branching involved in prostate gland morphogenesis
regulation of protein import into nucleus
positive regulation of cell differentiation
erythrocyte differentiation
smoothened signaling pathway
camera-type eye development
secondary heart field specification
negative regulation of phosphorylation
regulation of smooth muscle cell differentiation
regulation of cell fate commitment
regulation of branching involved in prostate gland morphogenesis
диференціація клітин
positive regulation of branching involved in lung morphogenesis
chondrocyte differentiation
regulation of cartilage development
organ induction
positive regulation of epithelial cell proliferation
epithelial cell proliferation involved in lung morphogenesis
negative regulation of cell proliferation involved in heart morphogenesis
negative regulation of apoptotic process
positive regulation of ossification
осифікація ендохондральна
regulation of smooth muscle cell proliferation
regulation of morphogenesis of a branching structure
BMP signaling pathway
macrophage differentiation
negative regulation of metanephric comma-shaped body morphogenesis
embryonic skeletal system development
mesenchymal cell proliferation involved in ureter development
osteoblast differentiation
hematopoietic progenitor cell differentiation
positive regulation of BMP signaling pathway
регуляція експресії генів
embryonic cranial skeleton morphogenesis
dorsal/ventral neural tube patterning
lung alveolus development
positive regulation of protein binding
anterior/posterior axis specification
GO:0045996 negative regulation of transcription, DNA-templated
positive regulation of epidermal cell differentiation
branching morphogenesis of an epithelial tube
trachea formation
specification of animal organ position
negative regulation of glomerular mesangial cell proliferation
positive regulation of smooth muscle cell proliferation
intermediate mesodermal cell differentiation
pulmonary artery endothelial tube morphogenesis
pituitary gland development
positive regulation of cell death
lung morphogenesis
positive regulation of endothelial cell proliferation
bud dilation involved in lung branching
positive regulation of cardiac muscle fiber development
negative regulation of striated muscle tissue development
positive regulation of cell migration
negative regulation of branch elongation involved in ureteric bud branching by BMP signaling pathway
BMP signaling pathway involved in nephric duct formation
positive regulation of pathway-restricted SMAD protein phosphorylation
negative regulation of mesenchymal cell proliferation involved in ureter development
mesoderm formation
cellular response to growth factor stimulus
glomerular capillary formation
bronchus development
positive regulation of endothelial cell migration
multicellular organism development
negative regulation of metanephric S-shaped body morphogenesis
neural tube closure
vasculature development
embryonic morphogenesis
protein localization to nucleus
positive regulation of apoptotic process
embryonic skeletal joint morphogenesis
регуляція диференціювання клітин
negative regulation of branching involved in ureteric bud morphogenesis
mesodermal cell differentiation
neuron fate commitment
forebrain development
cloacal septation
bone development
camera-type eye morphogenesis
positive regulation of SMAD protein signal transduction
negative regulation of glomerulus development
embryonic hindlimb morphogenesis
positive chemotaxis
outflow tract morphogenesis
odontogenesis
GO:1901227 negative regulation of transcription by RNA polymerase II
epithelial to mesenchymal transition involved in endocardial cushion formation
cardiac jelly development
cellular response to BMP stimulus
positive regulation of osteoblast differentiation
epithelial tube branching involved in lung morphogenesis
cardiac muscle cell differentiation
apoptotic process involved in endocardial cushion morphogenesis
muscular septum morphogenesis
GO:0003257, GO:0010735, GO:1901228, GO:1900622, GO:1904488 positive regulation of transcription by RNA polymerase II
positive regulation of bone mineralization
cardiac right ventricle morphogenesis
outflow tract septum morphogenesis
membranous septum morphogenesis
aortic valve morphogenesis
pulmonary valve morphogenesis
endocardial cushion development
endoderm development
coronary vasculature development
BMP signaling pathway involved in heart development
pharyngeal arch artery morphogenesis
positive regulation of cell proliferation involved in outflow tract morphogenesis
negative regulation of extrinsic apoptotic signaling pathway
regulation of pri-miRNA transcription by RNA polymerase II
positive regulation of production of miRNAs involved in gene silencing by miRNA
посттрансляційна модифікація
GO:1901313 positive regulation of gene expression
positive regulation of epithelial to mesenchymal transition
positive regulation of cardiac neural crest cell migration involved in outflow tract morphogenesis
regulation of signaling receptor activity
positive regulation of cell population proliferation
negative regulation of gene expression
negative regulation of pri-miRNA transcription by RNA polymerase II
regulation of apoptotic process
regulation of MAPK cascade
розвиток клітин
ріст

Джерела:Amigo / QuickGO
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
652
12159
Ensembl
ENSG00000125378
ENSMUSG00000021835
UniProt
P12644
P21275
RefSeq (мРНК)
NM_001202
NM_130850
NM_130851
NM_007554
NM_001316360
RefSeq (білок)
NP_001193
NP_570911
NP_001334841
NP_001334842
NP_001334843
NP_001334844
NP_001334845
NP_001334846
NP_570912
NP_001303289
NP_031580
Локус (UCSC) н/д Хр. 14: 46.62 – 46.63 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

BMP4 (англ. Bone morphogenetic protein 4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 14-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 408 амінокислот, а молекулярна маса — 46 555[4].

Послідовність амінокислот
1020304050
MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQS
HELLRDFEATLLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEQIH
STGLEYPERPASRANTVRSFHHEEHLENIPGTSENSAFRFLFNLSSIPEN
EVISSAELRLFREQVDQGPDWERGFHRINIYEVMKPPAEVVPGHLITRLL
DTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVTHLHQTRTHQGQ
HVRISRSLPQGSGNWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHSQR
ARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLN
STNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEM
VVEGCGCR

Кодований геном білок за функціями належить до цитокінів, факторів росту, білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах, як остеогенез, диференціація клітин. Локалізований у позаклітинному матриксі. Також секретований назовні.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Oida S., Iimura T., Maruoka Y., Takeda K., Sasaki S. (1995). Cloning and sequence of bone morphogenetic protein 4 (BMP-4) from a human placental cDNA library. DNA Seq. 5: 273—275. PMID 7579580 DOI:10.3109/10425179509030980

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:1071 (англ.) . Архів оригіналу за 12 червня 2017. Процитовано 11 вересня 2017.
  4. UniProt, P12644 (англ.) . Архів оригіналу за 17 вересня 2017. Процитовано 11 вересня 2017.

Див. також

  • Хромосома 14
Молекула міоглобіну Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.

П:  Портал «Біологія» П:  Портал «Хімія»